Host taxon 10090
Protein NP_001164382.1
proline-rich protein 13
Mus musculus
Gene Prr13, UniProt Q9CQJ5
>NP_001164382.1|Yersinia pseudotuberculosis IP 32953|proline-rich protein 13
MWNPNAGPNPYPPQVVCPGGSNPACPPPLNPAFPPGPCPPGIPQGNPAFPPCRPPYPVPQPGCPGYQPSGPYPPPYPPPAPGMCPVNPPAPGMVGPGIVIDKKTRKKMKKAHKKSHKHHKHGKHSSSSSSSSSSDSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.73 | 0.734733785793424 | 0.00012 | 28096329 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)