Host taxon 10090
Protein NP_001028397.2
proline-rich nuclear receptor coactivator 1
Mus musculus
Gene Pnrc1, UniProt Q3TWH3
>NP_001028397.2|Yersinia pseudotuberculosis IP 32953|proline-rich nuclear receptor coactivator 1
MTVVSVPQRDLALSGRLAPLGFLGALPMVNPAPPPLPRLPDPRALPPTLFLPHFLGGDGPCLAPAPRTTAPSGCTLAPAAAPRAAPKKRRKKKVRASPAGQLPSRFHQFQQHRPSLEGGRSPAPGPIVAQEERGLAATALLHRQPPLAKEVLKSKMGKSEKIALPHSQLVHGIHLCEQPKINRQKSKYNLPLTKITSAKRNESDFWQDSASSDRMQKQEKKSFKNTENIKSNHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPKPPSHWMGSTAENPSQSRELMAVHLKTLLKVQT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.52 | 0.516720482014145 | 0.013 | 28096329 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)