Host taxon 10090
Protein NP_033501.2
proline-rich acidic protein 1 precursor
Mus musculus
Gene Prap1, UniProt Q80XD8
>NP_033501.2|Yersinia pseudotuberculosis IP 32953|proline-rich acidic protein 1 precursor
MKRFLLATCLVAALLWEAGAAPAHQVPVKTKGKHVFPEQETEKVWDTRALEPLEKDNQLGPLLPEPKQKPAAAEEKRPDAMTWVETEDILSHLRSPLQGPELDLDSIDHPMSDDVQDEEVPQSRPILYRQVLQGPEEDLDHLAHSMEDS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.21 | -1.2079450906437 | 4.4e-9 | 28096329 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)