Host taxon 10090
Protein NP_001240711.1
prolactin receptor isoform 3 precursor
Mus musculus
Gene Prlr, UniProt Q08501
>NP_001240711.1|Yersinia pseudotuberculosis IP 32953|prolactin receptor isoform 3 precursor
MSSALAYMLLVLSISLLNGQSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKDTTVWIIVAVLSAVICLIMVWAVALKGYSMMTCIFPPVPGPKIKGFDTHLLELWCSILQLTSLVKIPTTEFLCDL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.1 | -2.09961992687252 | 1.4e-16 | 28096329 | |
Retrieved 1 of 4 entries in 0.8 ms
(Link to these results)