Host taxon 10090
Protein NP_001032628.1
prokineticin-2 isoform 2 precursor
Mus musculus
Gene Prok2, UniProt Q9QXU7
>NP_001032628.1|Yersinia pseudotuberculosis IP 32953|prokineticin-2 isoform 2 precursor
MGDPRCAPLLLLLLLPLLFTPPAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 5.73 | 5.72922062195412 | 1.5e-12 | 28096329 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)