Host taxon 10090
Protein NP_031976.1
proepiregulin preproprotein
Mus musculus
Gene Ereg, UniProt Q61521
>NP_031976.1|Yersinia pseudotuberculosis IP 32953|proepiregulin preproprotein
METLPASWVLTLLCLGSHLLQAVISTTVIPSCIPGESEDNCTALVQMEDDPRVAQVQITKCSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFLTVHQPLSKEYVALTVILIFLFLIITAGCIYYFCRWYKNRKSKKSREEYERVTSGDPVLPQV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.73 | 3.73491185392392 | 6.1e-53 | 28096329 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)