Host taxon 10090
Protein NP_001153107.1
probable RNA-binding protein 18 isoform 2
Mus musculus
Gene Rbm18, UniProt Q9CR83
>NP_001153107.1|Yersinia pseudotuberculosis IP 32953|probable RNA-binding protein 18 isoform 2
METETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPAQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.86 | 0.863168962091198 | 0.0098 | 28096329 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)