Host taxon 10090
Protein NP_001277447.1
probable low affinity copper uptake protein 2 isoform 2
Mus musculus
Gene Slc31a2, UniProt Q9CPU9
>NP_001277447.1|Yersinia pseudotuberculosis IP 32953|probable low affinity copper uptake protein 2 isoform 2
MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVIQVVIGYFVMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLNMT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.39 | 1.39004745228738 | 5.4e-10 | 28096329 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)