Host taxon 10090
Protein NP_067421.1
probable ergosterol biosynthetic protein 28 isoform 1
Mus musculus
Gene Erg28, UniProt Q9ERY9
>NP_067421.1|Yersinia pseudotuberculosis IP 32953|probable ergosterol biosynthetic protein 28 isoform 1
MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVFGTAAPTVGVLAPLMVASFSILGMLVGLRYLEAEPVSRQKKRN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1 | -1.00019897462499 | 4.0e-6 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)