Host taxon 10090
Protein NP_034391.1
prenylated Rab acceptor protein 1
Mus musculus
Gene Rabac1, UniProt Q9Z0S9
>NP_034391.1|Yersinia pseudotuberculosis IP 32953|prenylated Rab acceptor protein 1
MAAQKDQQKDAEGEGLSATTLLPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNVGELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLQSKLVLFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVLIGSHAAFHQMEPADGEELQMEPV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.62 | -0.619357664430608 | 0.033 | 28096329 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)