Host taxon 10090
Protein NP_001230021.1
predicted gene 3776
Mus musculus
Gene Gm3776, UniProt Q6P8Q0
>NP_001230021.1|Yersinia pseudotuberculosis IP 32953|predicted gene 3776
MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.07 | -2.07494871674484 | 3.8e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)