Host taxon 10090
Protein NP_001164426.1
predicted gene 15299 precursor
Mus musculus
Gene Defa27, UniProt F2Z403
>NP_001164426.1|Yersinia pseudotuberculosis IP 32953|predicted gene 15299 precursor
MKTLVLLSALALLASQVQADPIQNRDEESKIDEQPGKEDQAVSVSFGDPEGSSLQEESLRDLICYCRTRGCKRRERLNGTCRKGHLMYTLCCR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.93 | -2.92933346166298 | 1.7e-37 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)