Host taxon 10090
Protein NP_613068.1
PRA1 family protein 2
Mus musculus
Gene Praf2, UniProt Q9JIG8
>NP_613068.1|Yersinia pseudotuberculosis IP 32953|PRA1 family protein 2
MSEVRLPPLRALDDFVLGSARLAAPDPGDPQRWCHRVINNLLYYQTNYLLCFGISLALAGYIRPLHTLLSALVVVVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAISLFILWAVGGAFTFLLSITAPVFLILLHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.02 | 1.02463051773956 | 0.0012 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)