Host taxon 10090
Protein NP_001297534.1
polyamine-modulated factor 1 isoform 2
Mus musculus
Gene Pmf1, UniProt Q9CPV5
>NP_001297534.1|Yersinia pseudotuberculosis IP 32953|polyamine-modulated factor 1 isoform 2
MAEVSRDSEAAERGPEGSSPEAVPGDATIPRVKLLDAIVDTFLQKLVADRRRPSGIPEKDLCSVMAPYFLKQQDTLCHQVRKQEAKNQELADAVLAGRRQVEELQQQVRALQQTWQALHREQRELLSVLRAPE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.67 | -0.674549798814351 | 0.009 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)