Host taxon 10090
Protein NP_076389.2
pleckstrin homology domain-containing family J member 1
Mus musculus
Gene Plekhj1, UniProt Q9D240
>NP_076389.2|Yersinia pseudotuberculosis IP 32953|pleckstrin homology domain-containing family J member 1
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVAKRRLVKLVVNFLFYFRPDEAEPLGALLLERCRVAQEEPGGFSISFVEDLSRKYHFECCSQEQCQDWMEALQRASYEYMRQSLIFYRNEIRKMTGKDPLEQFGISEEARFQLNSLPKDGRTTCIGSQLNVLD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.92 | -0.922760465762848 | 0.026 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)