Host taxon 10090
Protein NP_663491.1
pleckstrin homology domain-containing family B member 2 isoform 1
Mus musculus
Gene Plekhb2, UniProt Q9QZC7
>NP_663491.1|Yersinia pseudotuberculosis IP 32953|pleckstrin homology domain-containing family B member 2 isoform 1
MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQSIEDKVHMPVDCINIRTGHECRDIQPPDGKPRDCLLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAILSEETAVAASPPPYAAYATPTPEVYGYGPYSGAYPAGTQVVYAANGQAYAVPYQYPYAGVYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.69 | -0.693711798546672 | 6.4e-6 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)