Host taxon 10090
Protein NP_032802.1
platelet-activating factor acetylhydrolase IB subunit gamma
Mus musculus
Gene Pafah1b3, UniProt Q61205
>NP_032802.1|Yersinia pseudotuberculosis IP 32953|platelet-activating factor acetylhydrolase IB subunit gamma
MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGIPLPETAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.4 | -1.40099749116519 | 8.1e-8 | 28096329 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)