Host taxon 10090
Protein NP_032801.2
platelet-activating factor acetylhydrolase IB subunit beta isoform d
Mus musculus
Gene Pafah1b2, UniProt Q61206
>NP_032801.2|Yersinia pseudotuberculosis IP 32953|platelet-activating factor acetylhydrolase IB subunit beta isoform d
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.52 | 0.521380886676685 | 0.01 | 28096329 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)