Host taxon 10090
Protein NP_666037.1
pituitary tumor-transforming gene 1 protein-interacting protein precursor
Mus musculus
Gene Pttg1ip, UniProt Q8R143
>NP_666037.1|Yersinia pseudotuberculosis IP 32953|pituitary tumor-transforming gene 1 protein-interacting protein precursor
MAPANLGLTPHWVMLLGAVLLLLLSGASAQEPPRVGCSEYTNRSCEECLRNVSCLWCNENKACMDYPVRKILPPASLCKLSSARWGVCWVNFEALIITMSVLGGSVLLGITVCCCYCCRRKKSRKPDKSDERAMREQEERRVRQEERRAEMKSRHDEIRKKYGLFKEQNPYEKF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.45 | -0.451885715624202 | 0.027 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)