Host taxon 10090
Protein NP_001139398.1
PILR alpha-associated neural protein precursor
Mus musculus
Gene Pianp, UniProt Q6P1B3
>NP_001139398.1|Yersinia pseudotuberculosis IP 32953|PILR alpha-associated neural protein precursor
MWSAQLLSQLLPLWPLLLLSVLPPAQGSSHRSPPAPARPPCVRGGPSAPRHVCVWERAPPPSRSPRVPRSRRQVVPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSVNPGFLPLDYGFAAPHGLATPHPNSDSMRDDGDGLILGETPATLRPFLFGGRGEGVDPQLYVTITISIIIVLVATGIIFKFCWDRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPQPKGAPAFQLNRIPLVNL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.85 | 0.854096678100327 | 0.013 | 28096329 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)