Host taxon 10090
Protein NP_058577.1
phosphomannomutase 2 isoform 1
Mus musculus
Gene Pmm2, UniProt Q9Z2M7
>NP_058577.1|Yersinia pseudotuberculosis IP 32953|phosphomannomutase 2 isoform 1
MATLCLFDMDGTLTAPRQKITEEMDGFLQKLRQKTKIGVVGGSDFEKLQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCKQNIQGHLGEDVIQDLINYCLSYIANIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKEHIRQKFVADLRKEFAGKGLTFSIGGQISIDVFPEGWDKRYCLRHLEHAGYKTIYFFGDKTMPGGNDHEIFTDPRTVGYTVTAPEDTRRICEGLFP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.48 | -0.478858296278236 | 0.019 | 28096329 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)