Host taxon 10090
Protein NP_542122.1
phospholipid phosphatase 3
Mus musculus
Gene Plpp3, UniProt Q99JY8
>NP_542122.1|Yersinia pseudotuberculosis IP 32953|phospholipid phosphatase 3
MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTTQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTSLSLPAPAIRREILSPVDIIDRNNHHNMV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.55 | -0.552035230279859 | 0.00046 | 28096329 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)