Host taxon 10090
Protein NP_001076000.1
phospholipase A2, membrane associated precursor
Mus musculus
Gene Pla2g2a, UniProt P31482
>NP_001076000.1|Yersinia pseudotuberculosis IP 32953|phospholipase A2, membrane associated precursor
MKVLLLLAASIMAFGSIQVQGNIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGKKPKC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.4 | -1.39757170489441 | 3.8e-11 | 28096329 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)