Bacterial taxon 273123
Protein WP_002210437.1
phospho-N-acetylmuramoyl-pentapeptide-transferase
Yersinia pseudotuberculosis IP 32953
Gene mraY, UniProt Q66EK8
>WP_002210437.1|Yersinia pseudotuberculosis IP 32953|phospho-N-acetylmuramoyl-pentapeptide-transferase
MLVWLAEYLVKFYSGFNVFSYLTFRAIVSLLTALFISLWMGPHLIAWLQKLQIGQVVRNDGPESHFSKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSIIALAAAFTMYSIGKDTSATELVVPFFKDIMPQLGLLYVLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFAAYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.67 | 1.66899652668376 | 0.0066 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.53 | 1.52866584550377 | 0.014 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.38 | -1.37563712089452 | 6.0e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.11 | -1.10697883234642 | 0.017 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 1 ms
(Link to these results)