Host taxon 10090
Protein NP_001288573.1
phosphatidylinositol transfer protein beta isoform isoform 3
Mus musculus
Gene Pitpnb, UniProt P53811
>NP_001288573.1|Yersinia pseudotuberculosis IP 32953|phosphatidylinositol transfer protein beta isoform isoform 3
MIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFHSVKTKRGPLGPNWKKELANTPDCPRMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.74 | 0.737533021701834 | 0.00081 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)