Host taxon 10090
Protein NP_032978.2
peroxisomal sarcosine oxidase
Mus musculus
Gene Pipox, UniProt Q9D826
>NP_032978.2|Yersinia pseudotuberculosis IP 32953|peroxisomal sarcosine oxidase
MAAQTDFWDAIVIGAGIQGCFTAYHLAKHSKSVLLLEQFFLPHSRGSSHGQSRIIRKAYPEDFYTMMMKECYQTWAQLEREAGTQLHRQTELLLLGTKENPGLKTIQATLSRQGIDHEYLSSVDLKQRFPNIRFTRGEVGLLDKTGGVLYADKALRALQHIICQLGGTVCDGEKVVEIRPGLPVTVKTTLKSYQANSLVITAGPWTNRLLHPLGIELPLQTLRINVCYWREKVPGSYGVSQAFPCILGLDLAPHHIYGLPASEYPGLMKICYHHGDNVDPEERDCPKTFSDIQDVQILCHFVRDHLPGLRAEPDIMERCMYTNTPDEHFILDCHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLPPSYDLAPFRMSRFSTLSKAHL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.75 | -2.75298982385783 | 1.6e-7 | 28096329 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)