Host taxon 10090
Protein NP_067509.1
peroxisomal membrane protein 4
Mus musculus
Gene Pxmp4, UniProt Q9JJW0
>NP_067509.1|Yersinia pseudotuberculosis IP 32953|peroxisomal membrane protein 4
MAAPPQLQALLQAVNKLLRQRRYHAALAVIKGFRNGAVYGVKIRAPHALVMTFLFRSGSLREKLQAILKATYIHSRNLACFVFAYKSLHALQSHVQGETHQMHSFLAAFIGGLLLFGENNNINSQINMYLTSRVLYALCRLGVEKGYIPALKWDPFPLHTAVIWGLVLWLFEYHRPTLQPSLQSSMTYLYEDSNVWHDLSDFLIFNKSHPSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.98 | -0.980992376100972 | 0.0067 | 28096329 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)