Host taxon 10090
Protein NP_032848.1
peroxisomal biogenesis factor 7 isoform 1
Mus musculus
Gene Pex7, UniProt P97865
>NP_032848.1|Yersinia pseudotuberculosis IP 32953|peroxisomal biogenesis factor 7 isoform 1
MSAARTLRVPGRHGYAAEFSPYLPGRLACAAAQHYGIAGCGTLLVLDQNESGLQIFRSFDWNDGLFDVTWSENNEHVLVTCSGDGSLQLWDTAKATGPLQVYKEHTQEVYSVDWSQTRGEQLVVSGSWDQTVKVWDPTVGNSLCTFRGHESVIYSTIWSPHIPGCFASASGDQTLRIWDVKTTGVRIVIPAHQTEILSCDWCKYNENLVVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDPLLETVEHHTEFTCGLDLSLQSPTQVADCSWDETIKIYDPVCLTVPG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.74 | -0.740660696529487 | 0.05 | 28096329 | |
Retrieved 1 of 2 entries in 2.2 ms
(Link to these results)