Host taxon 10090
Protein NP_036063.1
peroxisomal 2,4-dienoyl-CoA reductase
Mus musculus
Gene Decr2, UniProt Q9WV68
>NP_036063.1|Yersinia pseudotuberculosis IP 32953|peroxisomal 2,4-dienoyl-CoA reductase
MAQPPPDVEGDDCLPEYHHLFCPDLLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVGRSLQKVTTAAKKLVAATGKRCLPLSMDVRVPPEVMTAVDQALQEFGKINILINCAAGNFLCPASALSFNAFKTVVDIDTIGTFNVSSVLYKKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLRGSNASSKLKHFSNPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTFPNGIKQLLEFESFSAKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.07 | -1.07150841324158 | 0.00058 | 28096329 | |
Retrieved 1 of 2 entries in 2.2 ms
(Link to these results)