Host taxon 10090
Protein NP_036151.1
peroxiredoxin-5, mitochondrial isoform 1 precursor
Mus musculus
Gene Prdx5, UniProt P99029
>NP_036151.1|Yersinia pseudotuberculosis IP 32953|peroxiredoxin-5, mitochondrial isoform 1 precursor
MLQLGLRVLGCKASSVLRASTCLAGRAGRKEAGWECGGARSFSSSAVTMAPIKVGDAIPSVEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.76 | 0.755767495901275 | 0.00014 | 28096329 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)