Host taxon 10090
Protein NP_001289184.1
peripheral myelin protein 22 isoform 1
Mus musculus
Gene Pmp22, UniProt P16646
>NP_001289184.1|Yersinia pseudotuberculosis IP 32953|peripheral myelin protein 22 isoform 1
MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHTTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLALFLFFCQLFTLTKGGRFYITGFFQILAGLCVMSAAAIYTVRHSEWHVNTDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.9 | -1.89928284732175 | 7.6e-23 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)