Host taxon 10090
Protein NP_001289006.1
peptidyl-prolyl cis-trans isomerase FKBP1A isoform 1
Mus musculus
Gene Fkbp1a, UniProt P26883
>NP_001289006.1|Yersinia pseudotuberculosis IP 32953|peptidyl-prolyl cis-trans isomerase FKBP1A isoform 1
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.81 | 0.812523574786129 | 4.4e-5 | 28096329 | |
Retrieved 1 of 4 entries in 0.8 ms
(Link to these results)