Host taxon 10090
Protein NP_033428.1
peptidoglycan recognition protein 1 precursor
Mus musculus
Gene Pglyrp1, UniProt O88593
>NP_033428.1|Yersinia pseudotuberculosis IP 32953|peptidoglycan recognition protein 1 precursor
MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.89 | 0.887376459612741 | 0.0029 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)