Host taxon 10090
Protein NP_071315.1
p53 apoptosis effector related to PMP-22
Mus musculus
Gene Perp, UniProt Q9JK95
>NP_071315.1|Yersinia pseudotuberculosis IP 32953|p53 apoptosis effector related to PMP-22
MLRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSNHIQTSSLWWRCFDEGGGSGSYDDGCQSLMEYAWGRAAAATLFCGFIILCICFILSFFALCGPQMLVFLRVIGGLLALAAIFQIISLVIYPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCCLPNYEDDLLGAAKPRYFYPPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.66 | -0.656570129493891 | 0.0095 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)