Bacterial taxon 273123
Protein WP_011192764.1
outer membrane protein assembly factor BamC
Yersinia pseudotuberculosis IP 32953
Gene dapX, UniProt Q668F8
>WP_011192764.1|Yersinia pseudotuberculosis IP 32953|outer membrane protein assembly factor BamC
MAISLQKSTVVKVVGVSLVMLLAACSTDQRYKRQVSGDESYLTAPGLKPLNAPSGMILPIQNGEFDVRTVNSQGAVGKQLDIRPPVQPLTLLSGSRAENATDTSKLLLENSPQNRDLWAQVTRVLQDHNWPIASRQDASQTLTTDWIKWNRADEDVQFEGRYQISVQEQGYQLALVVKSLELQQGGKTITQYSEIQRYNSAMLNAIIEGLDKVRADSESSQASRKVGTLDVQSGSDDTGLPLLIVRAPYAVVWERLPAALEKVGMKVTDRSRPQGTVSVTSKSLSSSSWDALGAKDPELPEGDYKLQVGDLDNRSSLQFIGPKGHTLTQAQNDALVAVFQAAFSQTSATAIK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.53 | -1.53066653536224 | 6.3e-12 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.38 | -1.37919080820988 | 1.9e-7 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.06 | 1.0639059013676 | 0.0045 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.95 | -0.945374903312238 | 0.0019 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 1 ms
(Link to these results)