Host taxon 10090
Protein NP_001292377.1
osteocalcin-related protein precursor
Mus musculus
Gene Bglap3, UniProt P54615
>NP_001292377.1|Yersinia pseudotuberculosis IP 32953|osteocalcin-related protein precursor
MRTLSLLTLLALAALCLSDLTDATPTGPESDKAFMSKQEGNKVVNRLRRYLGASVPSPDPLEPTRELCELDPACDELSNQYGLKTAYRRIYGITI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.04 | 2.03501629588314 | 0.022 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)