Host taxon 10090
Protein NP_079937.1
ORM1-like protein 3
Mus musculus
Gene Ormdl3, UniProt Q9CPZ6
>NP_079937.1|Yersinia pseudotuberculosis IP 32953|ORM1-like protein 3
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILNTVSLMTVLIPKLPQLHGVRIFGINKY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.23 | -1.22835766340477 | 5.0e-8 | 28096329 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)