Host taxon 10090
Protein NP_849264.1
organic solute transporter subunit beta
Mus musculus
Gene Slc51b, UniProt Q80WK2
>NP_849264.1|Yersinia pseudotuberculosis IP 32953|organic solute transporter subunit beta
MDHSAEKAAANAEVPQELLEEMLWYFRAEDAAPWNYSILVLAVLVVMTSMFLLRRSILANRNRKKQPQDKETPEDLHLDDSIMKENNSQVFLRETLISEKPDLAPGEPELKEKDSSLVFLPDPQETES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.17 | -2.16713583592858 | 2.3e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)