Host taxon 10090
Protein NP_077195.2
oligoribonuclease, mitochondrial isoform 1 precursor
Mus musculus
Gene Rexo2, UniProt Q9D8S4
>NP_077195.2|Yersinia pseudotuberculosis IP 32953|oligoribonuclease, mitochondrial isoform 1 precursor
MLGVSLGARLLRGVGGRRGQFGARGVSEGSAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTVTLQQAEYEFLSFVRQQTPPGLCPLAGNSVHADKKFLDKHMPQFMKHLHYRIIDVSTVKELCRRWYPEDYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKTDEKKRKIIENGETEKPVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.73 | 0.73395294526573 | 0.00069 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)