Host taxon 10090
Protein NP_001153359.1
OCIA domain-containing protein 1 isoform 2
Mus musculus
Gene Ociad1, UniProt Q9CRD0
>NP_001153359.1|Yersinia pseudotuberculosis IP 32953|OCIA domain-containing protein 1 isoform 2
MNGRADFREPNAQVSRPIPDIGGGYIPTEEEWRLFAECHEECFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLLFACIVGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGELRRSSPPGHYTQKPKFDSNVSGQSSFGTSPAADNIEKEALPRYEPIPFSASMNESTPTGITDHIAQVKVNKYGDTWDE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.41 | 0.405598741314284 | 0.036 | 28096329 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)