Host taxon 10090
Protein NP_062704.2
nucleoside diphosphate kinase 3 precursor
Mus musculus
Gene Nme3, UniProt Q9WV85
>NP_062704.2|Yersinia pseudotuberculosis IP 32953|nucleoside diphosphate kinase 3 precursor
MICLVLTIFANLFPSAYSGVNERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELREKPFYSRLVKYMSSGPVVAMVWQGLDVVHASRALIGATDPGDAMPGTIRGDFCMEVGKNVIHGSDSVESAHREIALWFREAELLCWEDSAGHWLYE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.07 | -1.06853448350437 | 0.0092 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)