Host taxon 10090
Protein NP_076043.2
nucleolar protein 7
Mus musculus
Gene Nol7, UniProt Q9D7Z3
>NP_076043.2|Yersinia pseudotuberculosis IP 32953|nucleolar protein 7
MVQLRPRLSRIPAPAEAMVDEDQAASEEEEAEHGLLLAQPSSGAAAEPLDEEEDADDEAPEELTFASAQAEAREEELRVRASARRDKTLLKEKRKRREELFIEQKKRKLLPDAVLEQLTTASEADIKKSPENVKVNLKKKSEQHAKGRNSKKVKVQKVQSVGQIESYMAVRLKDEDLRDSRQEAAKHFIHSCLYGSDSKRTTVNKFLSLNNKRSPVKKAAAQFLTSTWGAQKQQNAKRFKKRWMAKKMKKKTYK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.63 | 0.632643603647137 | 0.012 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)