Host taxon 10090
Protein NP_001033701.1
noelin isoform b precursor
Mus musculus
Gene Olfm1, UniProt O88998
>NP_001033701.1|Yersinia pseudotuberculosis IP 32953|noelin isoform b precursor
MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTGVLPTNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLETKFKQVEESHKQHLARQFKG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.16 | 1.16454922205913 | 0.00014 | 28096329 | |
Retrieved 1 of 3 entries in 1.5 ms
(Link to these results)