Host taxon 10090
Protein NP_082300.1
NF-kappa-B inhibitor-interacting Ras-like protein 2
Mus musculus
Gene Nkiras2, UniProt Q9CR56
>NP_082300.1|Yersinia pseudotuberculosis IP 32953|NF-kappa-B inhibitor-interacting Ras-like protein 2
MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPKHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFIYLASKMTQPQSKSAFPLSRKNKGSGSLDG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.7 | -0.699067704811714 | 0.032 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)