Host taxon 10090
Protein NP_001103458.1
neuronal regeneration-related protein
Mus musculus
Gene Nrep, UniProt Q07475
>NP_001103458.1|Yersinia pseudotuberculosis IP 32953|neuronal regeneration-related protein
MVYYPELLVWVSQEPFAYKEMEGGLIKGRLPVPKEVNRKKMEETGAASLTPPGSREFTSPATSYLHPF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.82 | 0.823266261455522 | 0.021 | 28096329 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)