Host taxon 10090
Protein NP_032701.2
neuroblastoma suppressor of tumorigenicity 1 precursor
Mus musculus
Gene Nbl1, UniProt Q61477
>NP_032701.2|Yersinia pseudotuberculosis IP 32953|neuroblastoma suppressor of tumorigenicity 1 precursor
MLWVLVGAVLPVMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSHEGLNVYVQGEDSPGSQPGPHSHAHPHPGGQTPEPEEPPGAPQVEEEGAED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.95 | -0.951563132546219 | 1.2e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)