Host taxon 10090
Protein NP_080730.1
NEDD8-conjugating enzyme UBE2F
Mus musculus
Gene Ube2f, UniProt Q9CY34
>NP_080730.1|Yersinia pseudotuberculosis IP 32953|NEDD8-conjugating enzyme UBE2F
MLTLASKLKRDDGLKGSRTSASTSDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRDKVDEYIKRYAR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.57 | 0.571816314160736 | 0.043 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)