Host taxon 10090
Protein NP_001265344.1
NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial isoform 2
Mus musculus
Gene Ndufv2, UniProt Q9D6J6
>NP_001265344.1|Yersinia pseudotuberculosis IP 32953|NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial isoform 2
MNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.54 | -0.54362701956489 | 0.0084 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)