Host taxon 10090
Protein NP_080337.1
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial isoform 1 precursor
Mus musculus
Gene Ndufb8, UniProt Q9D6J5
>NP_080337.1|Yersinia pseudotuberculosis IP 32953|NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial isoform 1 precursor
MAAARAAALGVRWLQRTTRGVVPLEARRAFHMTKDMLPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLPNRSQHERDPWYQWDHSELRMNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCKHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEPVVHYDI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.9 | -0.895244128627564 | 0.00024 | 28096329 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)