Host taxon 10090
Protein NP_080888.1
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial precursor
Mus musculus
Gene Ndufb2, UniProt Q9CPU2
>NP_080888.1|Yersinia pseudotuberculosis IP 32953|NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial precursor
MSALTRLVPFGRVGGRLLRGCRARAAGDSGVRHAGGGVHIQPRYREFPQLTRSQVIQGEFLSSLMWFWILWRFWHDSDAVLGHFSYPDPSQWTDEELGIPPDDED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.14 | -1.14495979455797 | 4.2e-6 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)